Lineage for d1yzza_ (1yzz A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1289964Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (22 PDB entries)
  8. 1289996Domain d1yzza_: 1yzz A: [230440]
    automated match to d1yzzb_

Details for d1yzza_

PDB Entry: 1yzz (more details), 2.7 Å

PDB Description: Humanized caban33 at room temperature
PDB Compounds: (A:) anti-VSG immunoglobulin heavy chain variable domain cAbAn33

SCOPe Domain Sequences for d1yzza_:

Sequence, based on SEQRES records: (download)

>d1yzza_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgvrsireywgqgtqvtvs

Sequence, based on observed residues (ATOM records): (download)

>d1yzza_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
dvqlvesgggsvqaggslrlscavsgstyspcttgwvrqapgkglewvssisspgtiyyq
dsvkgrftisrdnakntvylqmnslqredtgmyycqiqcgsireywgqgtqvtvs

SCOPe Domain Coordinates for d1yzza_:

Click to download the PDB-style file with coordinates for d1yzza_.
(The format of our PDB-style files is described here.)

Timeline for d1yzza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yzzb_