SCOPe 2.07: Domain d1ytmb2: 1ytm B:1221-1518

Lineage for d1ytmb2 (1ytm B:1221-1518)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families)

5. Family c.91.1.0: automated matches [196141] (1 protein)
   not a true family

6. Protein automated matches [196142] (6 species)
   not a true protein

7. Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230436] (2 PDB entries)

8. Domain d1ytmb2: 1ytm B:1221-1518 [230439]
   Other proteins in same PDB: d1ytma1, d1ytmb1
   automated match to d1ayla1
   complexed with atp, mg, mn, oxd

Details for d1ytmb2

PDB Entry: 1ytm, 2.2 Å

PDB Description: crystal structure of phosphoenolpyruvate carboxykinase of anaerobiospirillum succiniciproducens complexed with atp, oxalate, magnesium and manganese ions

PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1ytmb2:

Sequence; same for both SEQRES and ATOM records:

>d1ytmb2 c.91.1.0 (B:1221-1518) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
iaamhcsantdlegkntaiffglsgtgkttlstdpkrlligddehgwdddgvfnfeggcy
akvinlskenepdiwgaikrnallenvtvdangkvdfadksvtentrvsypifhiknivk
pvskapaakrviflsadafgvlppvsilskeqtkyyflsgftaklagtergiteptptfs
scfgaafltlpptkyaevlvkrmeasgakaylvntgwngtgkrisikdtrgiidaildgs
idtantatipyfnftvptelkgvdtkildprntyadasewevkakdlaerfqknfkkf

Timeline for d1ytmb2:

• d1ytmb2 first appeared in SCOPe 2.03
  
• d1ytmb2 appears in SCOPe 2.06
  
• d1ytmb2 appears in the current release, SCOPe 2.08