![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
![]() | Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) ![]() |
![]() | Family c.91.1.0: automated matches [196141] (1 protein) not a true family |
![]() | Protein automated matches [196142] (6 species) not a true protein |
![]() | Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230436] (2 PDB entries) |
![]() | Domain d1ytmb2: 1ytm B:1221-1518 [230439] Other proteins in same PDB: d1ytma1, d1ytmb1 automated match to d1ayla1 complexed with atp, mg, mn, oxd |
PDB Entry: 1ytm (more details), 2.2 Å
SCOPe Domain Sequences for d1ytmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytmb2 c.91.1.0 (B:1221-1518) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]} iaamhcsantdlegkntaiffglsgtgkttlstdpkrlligddehgwdddgvfnfeggcy akvinlskenepdiwgaikrnallenvtvdangkvdfadksvtentrvsypifhiknivk pvskapaakrviflsadafgvlppvsilskeqtkyyflsgftaklagtergiteptptfs scfgaafltlpptkyaevlvkrmeasgakaylvntgwngtgkrisikdtrgiidaildgs idtantatipyfnftvptelkgvdtkildprntyadasewevkakdlaerfqknfkkf
Timeline for d1ytmb2: