Lineage for d1ytmb1 (1ytm B:1002-1220)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920813Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2920814Protein automated matches [226847] (5 species)
    not a true protein
  7. 2920815Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230434] (2 PDB entries)
  8. 2920817Domain d1ytmb1: 1ytm B:1002-1220 [230438]
    Other proteins in same PDB: d1ytma2, d1ytmb2
    automated match to d1os1a2
    complexed with atp, mg, mn, oxd

Details for d1ytmb1

PDB Entry: 1ytm (more details), 2.2 Å

PDB Description: crystal structure of phosphoenolpyruvate carboxykinase of anaerobiospirillum succiniciproducens complexed with atp, oxalate, magnesium and manganese ions
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1ytmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytmb1 c.109.1.0 (B:1002-1220) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqg

SCOPe Domain Coordinates for d1ytmb1:

Click to download the PDB-style file with coordinates for d1ytmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ytmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ytmb2