SCOPe 2.07: Domain d1ytma1: 1ytm A:2-220

Lineage for d1ytma1 (1ytm A:2-220)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Anaerobiospirillum succiniciproducens [TaxId:13335] [230434] (2 PDB entries)

8. Domain d1ytma1: 1ytm A:2-220 [230435]
   Other proteins in same PDB: d1ytma2, d1ytmb2
   automated match to d1os1a2
   complexed with atp, mg, mn, oxd

Details for d1ytma1

PDB Entry: 1ytm, 2.2 Å

PDB Description: crystal structure of phosphoenolpyruvate carboxykinase of anaerobiospirillum succiniciproducens complexed with atp, oxalate, magnesium and manganese ions

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1ytma1:

Sequence; same for both SEQRES and ATOM records:

>d1ytma1 c.109.1.0 (A:2-220) automated matches {Anaerobiospirillum succiniciproducens [TaxId: 13335]}
slseslakygitgatnivhnpsheelfaaetqaslegfekgtvtemgavnvmtgvytgrs
pkdkfivkneaskeiwwtsdefkndnkpvteeawaqlkalagkelsnkplyvvdlfcgan
entrlkirfvmevawqahfvtnmfirpteeelkgfepdfvvlnaskakvenfkelglnse
tavvfnlaekmqiilntwyggemkkgmfsmmnfylplqg

Timeline for d1ytma1:

• d1ytma1 first appeared in SCOPe 2.03
  
• d1ytma1 appears in SCOPe 2.06
  
• d1ytma1 appears in the current release, SCOPe 2.08