Lineage for d1yqqb_ (1yqq B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. Protein automated matches [190781] (46 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [230430] (2 PDB entries)
  8. Domain d1yqqb_: 1yqq B: [230432]
    automated match to d3odga_
    complexed with gun, po4

Details for d1yqqb_

PDB Entry: 1yqq (more details), 2.6 Å

PDB Description: Escherichia coli purine nucleoside phosphorylase II, the product of the xapA gene
PDB Compounds: (B:) Xanthosine phosphorylase

SCOPe Domain Sequences for d1yqqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqqb_ c.56.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
qfshnplfcidiiktykpdftprvafilgsglgaladqienavaisyeklpgfpvstvhg
hagelvlghlqgvpvvcmkgrghfyegrgmtimtdairtfkllgcellfctnaagslrpe
vgagslvalkdhintmpgtpmvglnddrfgerffslanaydaeyrallqkvakeegfplt
egvfvsypgpnfetaaeirmmqiiggdvvgmsvvpevisarhcdlkvvavsaitnmaegl
sdvklshaqtlaaaelskqnfinlicgflrkia

SCOPe Domain Coordinates for d1yqqb_ are not available.

Timeline for d1yqqb_:

Domains from other chains:
(mouse over for more information)
d1yqqa_, d1yqqc_