Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein Succinate dehydogenase [81669] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [254764] (6 PDB entries) |
Domain d1yq3b2: 1yq3 B:115-247 [230429] Other proteins in same PDB: d1yq3b1, d1yq3c_, d1yq3d_ automated match to d2bs2b1 complexed with bhg, f3s, fad, fes, gol, hem, pee, sf4, teo, unl, uq |
PDB Entry: 1yq3 (more details), 2.2 Å
SCOPe Domain Sequences for d1yq3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yq3b2 a.1.2.1 (B:115-247) Succinate dehydogenase {Chicken (Gallus gallus) [TaxId: 9031]} lsnfyaqyksiepylkkkdeskqgkeqylqsiedrqkldglyecilcaccstscpsywwn gdkylgpavlmqayrwmidsrddyteerlaqlqdpfslyrchtimnctrtcpkglnpgka iaeikkmmatyke
Timeline for d1yq3b2: