Lineage for d1ygga1 (1ygg A:4-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920699Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2920700Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2920701Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2920766Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (4 species)
  7. 2920767Species Actinobacillus succinogenes [TaxId:67854] [230419] (2 PDB entries)
  8. 2920769Domain d1ygga1: 1ygg A:4-227 [230420]
    Other proteins in same PDB: d1ygga2
    automated match to d1j3ba2
    complexed with na, so4

Details for d1ygga1

PDB Entry: 1ygg (more details), 1.85 Å

PDB Description: Crystal structure of phosphoenolpyruvate carboxykinase from Actinobacillus succinogenes
PDB Compounds: (A:) phosphoenolpyruvate carboxykinase

SCOPe Domain Sequences for d1ygga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygga1 c.109.1.1 (A:4-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Actinobacillus succinogenes [TaxId: 67854]}
dlnklvkelndlgltdvkeivynpsyeqlfeeetkpglegfdkgtlttlgavavdtgift
grspkdkyivcdettkdtvwwnseaakndnkpmtqetwkslrelvakqlsgkrlfvvegy
cgasekhrigvrmvtevawqahfvknmfirptdeelknfkadftvlngakctnpnwkeqg
lnsenfvafnitegiqliggtwyggemkkgmfsmmnyflplkg

SCOPe Domain Coordinates for d1ygga1:

Click to download the PDB-style file with coordinates for d1ygga1.
(The format of our PDB-style files is described here.)

Timeline for d1ygga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ygga2