Lineage for d1qnia1 (1qni A:451-581)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224942Family b.6.1.4: Nitrosocyanin [63392] (2 proteins)
  6. 224943Protein Nitrous oxide reductase, C-terminal domain [49548] (2 species)
  7. 224949Species Pseudomonas nautica [TaxId:2743] [49549] (1 PDB entry)
  8. 224950Domain d1qnia1: 1qni A:451-581 [23042]
    Other proteins in same PDB: d1qnia2, d1qnib2, d1qnic2, d1qnid2, d1qnie2, d1qnif2

Details for d1qnia1

PDB Entry: 1qni (more details), 2.4 Å

PDB Description: crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution

SCOP Domain Sequences for d1qnia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica}
kiyerndpyfascraqaekdgvtlesdnkvirdgnkvrvymtsvapqygmtdfkvkegde
vtvyitnldmvedvthgfcmvnhgvsmeispqqtasvtftagkpgvywyycnwfchalhm
emvgrmlveaa

SCOP Domain Coordinates for d1qnia1:

Click to download the PDB-style file with coordinates for d1qnia1.
(The format of our PDB-style files is described here.)

Timeline for d1qnia1: