Lineage for d1ydia1 (1ydi A:-4-128)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263535Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1263536Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1263582Protein automated matches [226863] (2 species)
    not a true protein
  7. 1263590Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)
  8. 1263594Domain d1ydia1: 1ydi A:-4-128 [230417]
    automated match to d1syqa1

Details for d1ydia1

PDB Entry: 1ydi (more details), 1.8 Å

PDB Description: Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's Vinculin-Binding Site (Residues 731-760)
PDB Compounds: (A:) vinculin isoform VCL

SCOPe Domain Sequences for d1ydia1:

Sequence, based on SEQRES records: (download)

>d1ydia1 a.24.9.1 (A:-4-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhhhhmpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlv
rvgketvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgi
lsgtsdllltfde

Sequence, based on observed residues (ATOM records): (download)

>d1ydia1 a.24.9.1 (A:-4-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hhhhhmpvfhtrtiesilepvaqqishlvimheaipdltapvaavqaavsnlvrvgketv
qttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsdl
lltfde

SCOPe Domain Coordinates for d1ydia1:

Click to download the PDB-style file with coordinates for d1ydia1.
(The format of our PDB-style files is described here.)

Timeline for d1ydia1: