Lineage for d1y51c_ (1y51 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1919250Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 1919251Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 1919252Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 1919269Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 1919318Species Geobacillus stearothermophilus [TaxId:1422] [230401] (3 PDB entries)
  8. 1919321Domain d1y51c_: 1y51 C: [230408]
    automated match to d1qfra_
    complexed with so4; mutant

Details for d1y51c_

PDB Entry: 1y51 (more details), 1.65 Å

PDB Description: x-ray crystal structure of bacillus stearothermophilus histidine phosphocarrier protein (hpr) f29w mutant
PDB Compounds: (C:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1y51c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y51c_ d.94.1.1 (C:) Histidine-containing phosphocarrier protein (HPr) {Geobacillus stearothermophilus [TaxId: 1422]}
aektfkvvsdsgiharpatilvqtaskwnseiqleyngktvnlksimgvmslgipkgati
kitaegadaaeamaaltdtlakeglae

SCOPe Domain Coordinates for d1y51c_:

Click to download the PDB-style file with coordinates for d1y51c_.
(The format of our PDB-style files is described here.)

Timeline for d1y51c_: