Lineage for d1y4yb_ (1y4y B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965911Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 2965912Superfamily d.94.1: HPr-like [55594] (2 families) (S)
  5. 2965913Family d.94.1.1: HPr-like [55595] (3 proteins)
    automatically mapped to Pfam PF00381
  6. 2965930Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species)
  7. 2965987Species Geobacillus stearothermophilus [TaxId:1422] [230401] (3 PDB entries)
  8. 2965992Domain d1y4yb_: 1y4y B: [230403]
    automated match to d1qfra_
    complexed with so4

Details for d1y4yb_

PDB Entry: 1y4y (more details), 2 Å

PDB Description: X-ray crystal structure of Bacillus stearothermophilus Histidine phosphocarrier protein (Hpr)
PDB Compounds: (B:) Phosphocarrier protein HPr

SCOPe Domain Sequences for d1y4yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4yb_ d.94.1.1 (B:) Histidine-containing phosphocarrier protein (HPr) {Geobacillus stearothermophilus [TaxId: 1422]}
aektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgati
kitaegadaaeamaaltdtlakeglae

SCOPe Domain Coordinates for d1y4yb_:

Click to download the PDB-style file with coordinates for d1y4yb_.
(The format of our PDB-style files is described here.)

Timeline for d1y4yb_: