| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (2 families) ![]() |
| Family d.94.1.1: HPr-like [55595] (3 proteins) automatically mapped to Pfam PF00381 |
| Protein Histidine-containing phosphocarrier protein (HPr) [55596] (8 species) |
| Species Geobacillus stearothermophilus [TaxId:1422] [230401] (3 PDB entries) |
| Domain d1y4ya_: 1y4y A: [230402] automated match to d1qfra_ complexed with so4 |
PDB Entry: 1y4y (more details), 2 Å
SCOPe Domain Sequences for d1y4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y4ya_ d.94.1.1 (A:) Histidine-containing phosphocarrier protein (HPr) {Geobacillus stearothermophilus [TaxId: 1422]}
aektfkvvsdsgiharpatilvqtaskfnseiqleyngktvnlksimgvmslgipkgati
kitaegadaaeamaaltdtlakeglae
Timeline for d1y4ya_: