Lineage for d1x56a2 (1x56 A:105-434)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1664082Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1664083Protein automated matches [226887] (8 species)
    not a true protein
  7. 1664124Species Pyrococcus horikoshii [TaxId:53953] [230395] (3 PDB entries)
  8. 1664127Domain d1x56a2: 1x56 A:105-434 [230400]
    Other proteins in same PDB: d1x56a1
    automated match to d1b8aa2

Details for d1x56a2

PDB Entry: 1x56 (more details), 1.98 Å

PDB Description: Crystal structure of asparaginyl-tRNA synthetase from Pyrococcus horikoshii
PDB Compounds: (A:) Asparaginyl-tRNA synthetase

SCOPe Domain Sequences for d1x56a2:

Sequence, based on SEQRES records: (download)

>d1x56a2 d.104.1.0 (A:105-434) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
pipenpeqaspellldyrhlhirtpkasaimkvketlimaarewllkdgwhevfppilvt
gaveggatlfklkyfdkyaylsqsaqlyleaaifglekvwsltpsfraeksrtrrhltef
whleleaawmdlwdimkveeelvsymvqrtlelrkkeiemfrddlttlknteppfprisy
deaidilqskgvnvewgddlgadeervlteefdrpffvygypkhikafymkedpndprkv
lasdmlapegygeiiggsqreddydkllnrileegmdpkdyewyldlrrygsvphsgfgl
gverlvawvlkldhirwaalfprtparlyp

Sequence, based on observed residues (ATOM records): (download)

>d1x56a2 d.104.1.0 (A:105-434) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
pipenpeqaspellldyrhlhirtpkasaimkvketlimaarewllkdgwhevfppilvt
lfklkyfdkyaylsqsaqlyleaaifglekvwsltpsfraehltefwhleleaawmdlwd
imkveeelvsymvqrtlelrkkeiemfrddlttlknteppfprisydeaidilqskgvnv
ewgddlgadeervlteefdrpffvygypkhikafymkedpndprkvlasdmlapegygei
iggsqreddydkllnrileegmdpkdyewyldlrrygsvphsgfglgverlvawvlkldh
irwaalfprtparlyp

SCOPe Domain Coordinates for d1x56a2:

Click to download the PDB-style file with coordinates for d1x56a2.
(The format of our PDB-style files is described here.)

Timeline for d1x56a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x56a1