![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [230395] (3 PDB entries) |
![]() | Domain d1x54a2: 1x54 A:105-434 [230396] Other proteins in same PDB: d1x54a1 automated match to d1b8aa2 protein/RNA complex; complexed with 4ad, mg, mpd |
PDB Entry: 1x54 (more details), 1.45 Å
SCOPe Domain Sequences for d1x54a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x54a2 d.104.1.0 (A:105-434) automated matches {Pyrococcus horikoshii [TaxId: 53953]} pipenpeqaspellldyrhlhirtpkasaimkvketlimaarewllkdgwhevfppilvt gaveggatlfklkyfdkyaylsqsaqlyleaaifglekvwsltpsfraeksrtrrhltef whleleaawmdlwdimkveeelvsymvqrtlelrkkeiemfrddlttlknteppfprisy deaidilqskgvnvewgddlgadeervlteefdrpffvygypkhikafymkedpndprkv lasdmlapegygeiiggsqreddydkllnrileegmdpkdyewyldlrrygsvphsgfgl gverlvawvlkldhirwaalfprtparlyp
Timeline for d1x54a2: