Lineage for d1x54a2 (1x54 A:105-434)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968197Species Pyrococcus horikoshii [TaxId:53953] [230395] (3 PDB entries)
  8. 2968198Domain d1x54a2: 1x54 A:105-434 [230396]
    Other proteins in same PDB: d1x54a1
    automated match to d1b8aa2
    protein/RNA complex; complexed with 4ad, mg, mpd

Details for d1x54a2

PDB Entry: 1x54 (more details), 1.45 Å

PDB Description: Crystal structure of asparaginyl-tRNA synthetase from Pyrococcus horikoshii complexed with asparaginyl-adenylate
PDB Compounds: (A:) Asparaginyl-tRNA synthetase

SCOPe Domain Sequences for d1x54a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x54a2 d.104.1.0 (A:105-434) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
pipenpeqaspellldyrhlhirtpkasaimkvketlimaarewllkdgwhevfppilvt
gaveggatlfklkyfdkyaylsqsaqlyleaaifglekvwsltpsfraeksrtrrhltef
whleleaawmdlwdimkveeelvsymvqrtlelrkkeiemfrddlttlknteppfprisy
deaidilqskgvnvewgddlgadeervlteefdrpffvygypkhikafymkedpndprkv
lasdmlapegygeiiggsqreddydkllnrileegmdpkdyewyldlrrygsvphsgfgl
gverlvawvlkldhirwaalfprtparlyp

SCOPe Domain Coordinates for d1x54a2:

Click to download the PDB-style file with coordinates for d1x54a2.
(The format of our PDB-style files is described here.)

Timeline for d1x54a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x54a1