SCOPe 2.07: Domain d1wydb2: 1wyd B:101-429

Lineage for d1wydb2 (1wyd B:101-429)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [230390] (1 PDB entry)

8. Domain d1wydb2: 1wyd B:101-429 [230393]
   Other proteins in same PDB: d1wyda1, d1wydb1
   automated match to d1b8aa2
   complexed with cl, epe, so4

Details for d1wydb2

PDB Entry: 1wyd, 2.3 Å

PDB Description: Crystal Structure of Aspartyl-tRNA synthetase from Sulfolobus tokodaii

PDB Compounds: (B:) hypothetical aspartyl-tRNA synthetase

SCOPe Domain Sequences for d1wydb2:

Sequence; same for both SEQRES and ATOM records:

>d1wydb2 d.104.1.0 (B:101-429) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
plpldvsgkvkadidtrlrervldlrrqemqavikiqslalkafretlykegfieiftpk
iiasateggaqlfpviyfgkeaflaqspqlykelmagvvervfevapawraeesdtpfhl
aefismdvemafadyndvmqllekilhnivktikeegkeelkilnyeppevkipikrlky
teaieilrskgynikfgddigtpelrilneelkedlyfivdwpsdarpfytksksenpel
sesfdliykfleivsgstrnhkrevleealkkkglkpesfefflkwfdygmpphagfgmg
larlmvmltgiqsvkeivpfprdkkrltp

Timeline for d1wydb2:

• d1wydb2 first appeared in SCOPe 2.03
  
• d1wydb2 appears in SCOPe 2.06
  
• d1wydb2 appears in the current release, SCOPe 2.08