![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Sulfolobus tokodaii [TaxId:273063] [230390] (1 PDB entry) |
![]() | Domain d1wydb2: 1wyd B:101-429 [230393] Other proteins in same PDB: d1wyda1, d1wydb1 automated match to d1b8aa2 complexed with cl, epe, so4 |
PDB Entry: 1wyd (more details), 2.3 Å
SCOPe Domain Sequences for d1wydb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wydb2 d.104.1.0 (B:101-429) automated matches {Sulfolobus tokodaii [TaxId: 273063]} plpldvsgkvkadidtrlrervldlrrqemqavikiqslalkafretlykegfieiftpk iiasateggaqlfpviyfgkeaflaqspqlykelmagvvervfevapawraeesdtpfhl aefismdvemafadyndvmqllekilhnivktikeegkeelkilnyeppevkipikrlky teaieilrskgynikfgddigtpelrilneelkedlyfivdwpsdarpfytksksenpel sesfdliykfleivsgstrnhkrevleealkkkglkpesfefflkwfdygmpphagfgmg larlmvmltgiqsvkeivpfprdkkrltp
Timeline for d1wydb2: