Lineage for d1wydb1 (1wyd B:1-100)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790411Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2790412Protein automated matches [190576] (52 species)
    not a true protein
  7. 2790695Species Sulfolobus tokodaii [TaxId:273063] [230388] (1 PDB entry)
  8. 2790697Domain d1wydb1: 1wyd B:1-100 [230392]
    Other proteins in same PDB: d1wyda2, d1wydb2
    automated match to d1b8aa1
    complexed with cl, epe, so4

Details for d1wydb1

PDB Entry: 1wyd (more details), 2.3 Å

PDB Description: Crystal Structure of Aspartyl-tRNA synthetase from Sulfolobus tokodaii
PDB Compounds: (B:) hypothetical aspartyl-tRNA synthetase

SCOPe Domain Sequences for d1wydb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wydb1 b.40.4.0 (B:1-100) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
myrshfiadvtpeydgkeviwagwvhllrdlggkkfiilrdktglgqvvvdknssafgis
qeltqesviqvrgivkadkraprgielhaeeitllskaka

SCOPe Domain Coordinates for d1wydb1:

Click to download the PDB-style file with coordinates for d1wydb1.
(The format of our PDB-style files is described here.)

Timeline for d1wydb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wydb2