SCOPe 2.08: Domain d1wydb1: 1wyd B:1-100

Lineage for d1wydb1 (1wyd B:1-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [230388] (1 PDB entry)

8. Domain d1wydb1: 1wyd B:1-100 [230392]
   Other proteins in same PDB: d1wyda2, d1wydb2
   automated match to d1b8aa1
   complexed with cl, epe, so4

Details for d1wydb1

PDB Entry: 1wyd, 2.3 Å

PDB Description: Crystal Structure of Aspartyl-tRNA synthetase from Sulfolobus tokodaii

PDB Compounds: (B:) hypothetical aspartyl-tRNA synthetase

SCOPe Domain Sequences for d1wydb1:

Sequence; same for both SEQRES and ATOM records:

>d1wydb1 b.40.4.0 (B:1-100) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
myrshfiadvtpeydgkeviwagwvhllrdlggkkfiilrdktglgqvvvdknssafgis
qeltqesviqvrgivkadkraprgielhaeeitllskaka

Timeline for d1wydb1:

• d1wydb1 first appeared in SCOPe 2.03
  
• d1wydb1 appears in SCOPe 2.07