Lineage for d1wyda2 (1wyd A:101-429)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1664082Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1664083Protein automated matches [226887] (8 species)
    not a true protein
  7. 1664132Species Sulfolobus tokodaii [TaxId:273063] [230390] (1 PDB entry)
  8. 1664133Domain d1wyda2: 1wyd A:101-429 [230391]
    Other proteins in same PDB: d1wyda1, d1wydb1
    automated match to d1b8aa2
    complexed with cl, epe, so4

Details for d1wyda2

PDB Entry: 1wyd (more details), 2.3 Å

PDB Description: Crystal Structure of Aspartyl-tRNA synthetase from Sulfolobus tokodaii
PDB Compounds: (A:) hypothetical aspartyl-tRNA synthetase

SCOPe Domain Sequences for d1wyda2:

Sequence, based on SEQRES records: (download)

>d1wyda2 d.104.1.0 (A:101-429) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
plpldvsgkvkadidtrlrervldlrrqemqavikiqslalkafretlykegfieiftpk
iiasateggaqlfpviyfgkeaflaqspqlykelmagvvervfevapawraeesdtpfhl
aefismdvemafadyndvmqllekilhnivktikeegkeelkilnyeppevkipikrlky
teaieilrskgynikfgddigtpelrilneelkedlyfivdwpsdarpfytksksenpel
sesfdliykfleivsgstrnhkrevleealkkkglkpesfefflkwfdygmpphagfgmg
larlmvmltgiqsvkeivpfprdkkrltp

Sequence, based on observed residues (ATOM records): (download)

>d1wyda2 d.104.1.0 (A:101-429) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
plpldvsgkvkadidtrlrervldlrrqemqavikiqslalkafretlykegfieiftpk
iiasateggaqlfpviyfgkeaflaqspqlykelmagvvervfevapawraeesdtpfhl
aefismdvemafadyndvmqllekilhnivktikeegkeelkilnyeppevkipikrlky
teaieilrskgynikfgddigtpelrilneelkedlyfivdwpsdarpfytksksepels
esfdliykfleivsgstrnhkrevleealkkkglkpesfefflkwfdygmpphagfgmgl
arlmvmltgiqsvkeivpfprdkkrltp

SCOPe Domain Coordinates for d1wyda2:

Click to download the PDB-style file with coordinates for d1wyda2.
(The format of our PDB-style files is described here.)

Timeline for d1wyda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wyda1