Lineage for d1wyda1 (1wyd A:1-100)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2060461Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2060462Protein automated matches [190576] (33 species)
    not a true protein
  7. 2060623Species Sulfolobus tokodaii [TaxId:273063] [230388] (1 PDB entry)
  8. 2060624Domain d1wyda1: 1wyd A:1-100 [230389]
    Other proteins in same PDB: d1wyda2, d1wydb2
    automated match to d1b8aa1
    complexed with cl, epe, so4

Details for d1wyda1

PDB Entry: 1wyd (more details), 2.3 Å

PDB Description: Crystal Structure of Aspartyl-tRNA synthetase from Sulfolobus tokodaii
PDB Compounds: (A:) hypothetical aspartyl-tRNA synthetase

SCOPe Domain Sequences for d1wyda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyda1 b.40.4.0 (A:1-100) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
myrshfiadvtpeydgkeviwagwvhllrdlggkkfiilrdktglgqvvvdknssafgis
qeltqesviqvrgivkadkraprgielhaeeitllskaka

SCOPe Domain Coordinates for d1wyda1:

Click to download the PDB-style file with coordinates for d1wyda1.
(The format of our PDB-style files is described here.)

Timeline for d1wyda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wyda2