Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (18 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [230388] (1 PDB entry) |
Domain d1wyda1: 1wyd A:1-100 [230389] Other proteins in same PDB: d1wyda2, d1wydb2 automated match to d1b8aa1 complexed with cl, epe, so4 |
PDB Entry: 1wyd (more details), 2.3 Å
SCOPe Domain Sequences for d1wyda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyda1 b.40.4.0 (A:1-100) automated matches {Sulfolobus tokodaii [TaxId: 273063]} myrshfiadvtpeydgkeviwagwvhllrdlggkkfiilrdktglgqvvvdknssafgis qeltqesviqvrgivkadkraprgielhaeeitllskaka
Timeline for d1wyda1: