SCOPe 2.03: Domain d1wnha2: 1wnh A:99-217

Lineage for d1wnha2 (1wnh A:99-217)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.5: Latexin-like [142991] (2 proteins)
   Pfam PF06907; duplication: consits of two domains of this fold

6. Protein automated matches [230383] (1 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [230384] (1 PDB entry)

8. Domain d1wnha2: 1wnh A:99-217 [230385]
   Other proteins in same PDB: d1wnha1
   automated match to d2bo9b2

Details for d1wnha2

PDB Entry: 1wnh, 1.83 Å

PDB Description: Crystal structure of mouse Latexin (tissue carboxypeptidase inhibitor)

PDB Compounds: (A:) Latexin

SCOPe Domain Sequences for d1wnha2:

Sequence; same for both SEQRES and ATOM records:

>d1wnha2 d.17.1.5 (A:99-217) automated matches {Mus musculus [TaxId: 10090]}
pdeedntfyqslmslkrpleaqdipdnfgnvspqmkpvqhlawvacgyvmwqnstedtwy
kmlkiqtvkqvqrnddfieldytillhdiasqeiipwqmqvlwhpqygtkvkhnsrlpk

Timeline for d1wnha2:

• d1wnha2 is new in SCOPe 2.03-stable
  
• d1wnha2 appears in SCOPe 2.04
  
• d1wnha2 appears in the current release, SCOPe 2.08