Lineage for d1w8jd2 (1w8j D:63-766)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111712Species Chicken (Gallus gallus) [TaxId:9031] [230373] (2 PDB entries)
  8. 2111716Domain d1w8jd2: 1w8j D:63-766 [230380]
    Other proteins in same PDB: d1w8ja1, d1w8jb1, d1w8jc1, d1w8jd1
    automated match to d1oe9a2
    complexed with so4

Details for d1w8jd2

PDB Entry: 1w8j (more details), 2.7 Å

PDB Description: crystal structure of myosin v motor domain -nucleotide-free
PDB Compounds: (D:) myosin va

SCOPe Domain Sequences for d1w8jd2:

Sequence, based on SEQRES records: (download)

>d1w8jd2 c.37.1.9 (D:63-766) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnka
lhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekpr
lsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekaisp
tsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvrci
kpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdvls
drkqtcknvleklildkdkyqfgktkiffragqvaylekiradk

Sequence, based on observed residues (ATOM records): (download)

>d1w8jd2 c.37.1.9 (D:63-766) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtylle
ksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgiddakem
vntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcdlmg
vdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnkalhs
tvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipdf
ydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnkafi
ikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelftskehkktvghqfrns
lhllmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwt
yqeffsryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekir
adk

SCOPe Domain Coordinates for d1w8jd2:

Click to download the PDB-style file with coordinates for d1w8jd2.
(The format of our PDB-style files is described here.)

Timeline for d1w8jd2: