Lineage for d1qleb1 (1qle B:108-252)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380835Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2380836Protein Cytochrome c oxidase [49544] (4 species)
  7. 2380924Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries)
  8. 2380928Domain d1qleb1: 1qle B:108-252 [23038]
    Other proteins in same PDB: d1qlea_, d1qleb2, d1qlec_, d1qled_, d1qleh_, d1qlel_
    complexed with ca, cu, cua, hea, mn, pc1

Details for d1qleb1

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
PDB Compounds: (B:) cytochrome c oxidase polypeptide II

SCOPe Domain Sequences for d1qleb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qleb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

SCOPe Domain Coordinates for d1qleb1:

Click to download the PDB-style file with coordinates for d1qleb1.
(The format of our PDB-style files is described here.)

Timeline for d1qleb1: