![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries) |
![]() | Domain d1qleb1: 1qle B:108-252 [23038] Other proteins in same PDB: d1qlea_, d1qleb2, d1qlec_, d1qled_, d1qleh_, d1qlel_ complexed with ca, cu, cua, hea, mn, pc1 |
PDB Entry: 1qle (more details), 3 Å
SCOPe Domain Sequences for d1qleb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qleb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]} ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym pivvkavsqekyeawlagakeefaa
Timeline for d1qleb1: