Lineage for d1w8jd1 (1w8j D:5-62)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536746Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 1536803Family b.34.3.0: automated matches [227148] (1 protein)
    not a true family
  6. 1536804Protein automated matches [226852] (3 species)
    not a true protein
  7. 1536805Species Chicken (Gallus gallus) [TaxId:9031] [230370] (2 PDB entries)
  8. 1536809Domain d1w8jd1: 1w8j D:5-62 [230379]
    Other proteins in same PDB: d1w8ja2, d1w8jb2, d1w8jc2, d1w8jd2
    automated match to d1oe9a1
    complexed with so4

Details for d1w8jd1

PDB Entry: 1w8j (more details), 2.7 Å

PDB Description: crystal structure of myosin v motor domain -nucleotide-free
PDB Compounds: (D:) myosin va

SCOPe Domain Sequences for d1w8jd1:

Sequence, based on SEQRES records: (download)

>d1w8jd1 b.34.3.0 (D:5-62) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl

Sequence, based on observed residues (ATOM records): (download)

>d1w8jd1 b.34.3.0 (D:5-62) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrldleycldpktkelppl

SCOPe Domain Coordinates for d1w8jd1:

Click to download the PDB-style file with coordinates for d1w8jd1.
(The format of our PDB-style files is described here.)

Timeline for d1w8jd1: