SCOPe 2.08: Domain d1w8jc1: 1w8j C:1-62

Lineage for d1w8jc1 (1w8j C:1-62)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.0: automated matches [227148] (1 protein)
   not a true family

6. Protein automated matches [226852] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [230370] (2 PDB entries)

8. Domain d1w8jc1: 1w8j C:1-62 [230377]
   Other proteins in same PDB: d1w8ja2, d1w8jb2, d1w8jc2, d1w8jd2
   automated match to d1oe9a1
   complexed with so4

Details for d1w8jc1

PDB Entry: 1w8j, 2.7 Å

PDB Description: crystal structure of myosin v motor domain -nucleotide-free

PDB Compounds: (C:) myosin va

SCOPe Domain Sequences for d1w8jc1:

Sequence, based on SEQRES records:

>d1w8jc1 b.34.3.0 (C:1-62) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelp
pl

Sequence, based on observed residues (ATOM records):

>d1w8jc1 b.34.3.0 (C:1-62) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
maaselytkyarvwipdpeevwksaellkdykpgdkvlqlrldleycldpktkelppl

Timeline for d1w8jc1:

• d1w8jc1 first appeared in SCOPe 2.03
  
• d1w8jc1 appears in SCOPe 2.07