Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) |
Family b.34.3.0: automated matches [227148] (1 protein) not a true family |
Protein automated matches [226852] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [230370] (2 PDB entries) |
Domain d1w8ja1: 1w8j A:2-62 [230372] Other proteins in same PDB: d1w8ja2, d1w8jb2, d1w8jc2, d1w8jd2 automated match to d1oe9a1 complexed with so4 |
PDB Entry: 1w8j (more details), 2.7 Å
SCOPe Domain Sequences for d1w8ja1:
Sequence, based on SEQRES records: (download)
>d1w8ja1 b.34.3.0 (A:2-62) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} aaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelpp l
>d1w8ja1 b.34.3.0 (A:2-62) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} aaselytkyarvwipdpeevwksaellkdykpgdkvlqlrldleycldpktkelppl
Timeline for d1w8ja1: