Lineage for d1ar1b1 (1ar1 B:108-252)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528012Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1528013Protein Cytochrome c oxidase [49544] (4 species)
  7. 1528065Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries)
  8. 1528068Domain d1ar1b1: 1ar1 B:108-252 [23037]
    Other proteins in same PDB: d1ar1a_, d1ar1b2, d1ar1c_, d1ar1d_
    complexed with ca, cu, hea, lda, mg

Details for d1ar1b1

PDB Entry: 1ar1 (more details), 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1ar1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar1b1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa

SCOPe Domain Coordinates for d1ar1b1:

Click to download the PDB-style file with coordinates for d1ar1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ar1b1: