| Class b: All beta proteins [48724] (174 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
| Protein Cytochrome c oxidase [49544] (4 species) |
| Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries) |
| Domain d1ar1b1: 1ar1 B:108-252 [23037] Other proteins in same PDB: d1ar1a_, d1ar1b2, d1ar1c_, d1ar1d_ complexed with ca, cu, hea, lda, mg |
PDB Entry: 1ar1 (more details), 2.7 Å
SCOPe Domain Sequences for d1ar1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ar1b1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]}
ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg
kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym
pivvkavsqekyeawlagakeefaa
Timeline for d1ar1b1: