Lineage for d1w4rd2 (1w4r D:151-191)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1463401Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1463402Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1463917Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1463918Protein automated matches [190463] (4 species)
    not a true protein
  7. 1463948Species Human (Homo sapiens) [TaxId:9606] [187379] (3 PDB entries)
  8. 1463952Domain d1w4rd2: 1w4r D:151-191 [230361]
    Other proteins in same PDB: d1w4ra1, d1w4rb1, d1w4rc1, d1w4rd1, d1w4re1, d1w4rf1, d1w4rg1, d1w4rh1
    automated match to d1xbta2
    complexed with dtu, ttp, zn

Details for d1w4rd2

PDB Entry: 1w4r (more details), 1.83 Å

PDB Description: Structure of a type II thymidine kinase with bound dTTP
PDB Compounds: (D:) Thymidine kinase

SCOPe Domain Sequences for d1w4rd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4rd2 g.39.1.0 (D:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk

SCOPe Domain Coordinates for d1w4rd2:

Click to download the PDB-style file with coordinates for d1w4rd2.
(The format of our PDB-style files is described here.)

Timeline for d1w4rd2: