| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins) N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684) |
| Protein automated matches [230352] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [230353] (2 PDB entries) |
| Domain d1w4rd1: 1w4r D:18-150 [230360] Other proteins in same PDB: d1w4ra2, d1w4rb2, d1w4rc2, d1w4rd2, d1w4re2, d1w4rf2, d1w4rg2, d1w4rh2 automated match to d1xbta1 complexed with dtu, ttp, zn |
PDB Entry: 1w4r (more details), 1.83 Å
SCOPe Domain Sequences for d1w4rd1:
Sequence, based on SEQRES records: (download)
>d1w4rd1 c.37.1.24 (D:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt
>d1w4rd1 c.37.1.24 (D:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtralpacllrdvaqealgv
avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt
Timeline for d1w4rd1: