Lineage for d1w4ra2 (1w4r A:151-191)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705677Family g.39.1.0: automated matches [191378] (1 protein)
    not a true family
  6. 1705678Protein automated matches [190463] (6 species)
    not a true protein
  7. 1705710Species Human (Homo sapiens) [TaxId:9606] [187379] (9 PDB entries)
  8. 1705711Domain d1w4ra2: 1w4r A:151-191 [230357]
    Other proteins in same PDB: d1w4ra1, d1w4rb1, d1w4rc1, d1w4rd1, d1w4re1, d1w4rf1, d1w4rg1, d1w4rh1
    automated match to d1xbta2
    complexed with dtu, ttp, zn

Details for d1w4ra2

PDB Entry: 1w4r (more details), 1.83 Å

PDB Description: Structure of a type II thymidine kinase with bound dTTP
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d1w4ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ra2 g.39.1.0 (A:151-191) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcmecfreaaytkrlgtekeveviggadkyhsvcrlcyfk

SCOPe Domain Coordinates for d1w4ra2:

Click to download the PDB-style file with coordinates for d1w4ra2.
(The format of our PDB-style files is described here.)

Timeline for d1w4ra2: