Lineage for d1w4ra1 (1w4r A:18-150)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597869Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 1597896Protein automated matches [230352] (1 species)
    not a true protein
  7. 1597897Species Human (Homo sapiens) [TaxId:9606] [230353] (2 PDB entries)
  8. 1597898Domain d1w4ra1: 1w4r A:18-150 [230356]
    Other proteins in same PDB: d1w4ra2, d1w4rb2, d1w4rc2, d1w4rd2, d1w4re2, d1w4rf2, d1w4rg2, d1w4rh2
    automated match to d1xbta1
    complexed with dtu, ttp, zn

Details for d1w4ra1

PDB Entry: 1w4r (more details), 1.83 Å

PDB Description: Structure of a type II thymidine kinase with bound dTTP
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d1w4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w4ra1 c.37.1.24 (A:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt

SCOPe Domain Coordinates for d1w4ra1:

Click to download the PDB-style file with coordinates for d1w4ra1.
(The format of our PDB-style files is described here.)

Timeline for d1w4ra1: