| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
| Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
| Protein automated matches [227057] (4 species) not a true protein |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230343] (2 PDB entries) |
| Domain d1vtob2: 1vto B:1107-1198 [230351] automated match to d1mp9a2 protein/DNA complex |
PDB Entry: 1vto (more details), 1.9 Å
SCOPe Domain Sequences for d1vtob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vtob2 d.129.1.0 (B:1107-1198) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pakfkdfkiqnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifv
sgkivitgakmrdetykafeniypvlsefrki
Timeline for d1vtob2: