SCOPe 2.08: Domain d1vtob2: 1vto B:1107-1198

Lineage for d1vtob2 (1vto B:1107-1198)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (4 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230343] (2 PDB entries)

8. Domain d1vtob2: 1vto B:1107-1198 [230351]
   automated match to d1mp9a2
   protein/DNA complex

Details for d1vtob2

PDB Entry: 1vto, 1.9 Å

PDB Description: 1.9 a resolution refined structure of tbp recognizing the minor groove of tataaaag

PDB Compounds: (B:) tata binding protein

SCOPe Domain Sequences for d1vtob2:

Sequence; same for both SEQRES and ATOM records:

>d1vtob2 d.129.1.0 (B:1107-1198) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pakfkdfkiqnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifv
sgkivitgakmrdetykafeniypvlsefrki

Timeline for d1vtob2:

• d1vtob2 first appeared in SCOPe 2.03
  
• d1vtob2 appears in SCOPe 2.07