SCOPe 2.03: Domain d1vtoa2: 1vto A:107-198

Lineage for d1vtoa2 (1vto A:107-198)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (3 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [230343] (2 PDB entries)

8. Domain d1vtoa2: 1vto A:107-198 [230349]
   automated match to d1mp9a2
   protein/DNA complex

Details for d1vtoa2

PDB Entry: 1vto, 1.9 Å

PDB Description: 1.9 a resolution refined structure of tbp recognizing the minor groove of tataaaag

PDB Compounds: (A:) tata binding protein

SCOPe Domain Sequences for d1vtoa2:

Sequence; same for both SEQRES and ATOM records:

>d1vtoa2 d.129.1.0 (A:107-198) automated matches {Arabidopsis thaliana [TaxId: 3702]}
pakfkdfkiqnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifv
sgkivitgakmrdetykafeniypvlsefrki

Timeline for d1vtoa2:

• d1vtoa2 is new in SCOPe 2.03-stable
  
• d1vtoa2 appears in SCOPe 2.04
  
• d1vtoa2 appears in the current release, SCOPe 2.08