Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
Protein automated matches [227057] (3 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [230343] (2 PDB entries) |
Domain d1vtoa2: 1vto A:107-198 [230349] automated match to d1mp9a2 protein/DNA complex |
PDB Entry: 1vto (more details), 1.9 Å
SCOPe Domain Sequences for d1vtoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vtoa2 d.129.1.0 (A:107-198) automated matches {Arabidopsis thaliana [TaxId: 3702]} pakfkdfkiqnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifv sgkivitgakmrdetykafeniypvlsefrki
Timeline for d1vtoa2: