Lineage for d1vtoa1 (1vto A:12-106)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581739Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2581921Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 2581922Protein automated matches [227057] (4 species)
    not a true protein
  7. 2581950Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230343] (2 PDB entries)
  8. 2581951Domain d1vtoa1: 1vto A:12-106 [230348]
    automated match to d1mp9a1
    protein/DNA complex

Details for d1vtoa1

PDB Entry: 1vto (more details), 1.9 Å

PDB Description: 1.9 a resolution refined structure of tbp recognizing the minor groove of tataaaag
PDB Compounds: (A:) tata binding protein

SCOPe Domain Sequences for d1vtoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vtoa1 d.129.1.0 (A:12-106) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vdlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepktta
lifasgkmvctgaksedfskmaarkyarivqklgf

SCOPe Domain Coordinates for d1vtoa1:

Click to download the PDB-style file with coordinates for d1vtoa1.
(The format of our PDB-style files is described here.)

Timeline for d1vtoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vtoa2