Lineage for d1vtlf2 (1vtl F:107-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975391Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 2975392Protein automated matches [227057] (4 species)
    not a true protein
  7. 2975420Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230343] (2 PDB entries)
  8. 2975428Domain d1vtlf2: 1vtl F:107-198 [230347]
    automated match to d1mp9a2
    protein/DNA complex

Details for d1vtlf2

PDB Entry: 1vtl (more details), 2.25 Å

PDB Description: co-crystal structure of tbp recognizing the minor groove of a tata element
PDB Compounds: (F:) tata binding protein (tbp)

SCOPe Domain Sequences for d1vtlf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vtlf2 d.129.1.0 (F:107-198) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pakfkdfkiqnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifv
sgkivitgakmrdetykafeniypvlsefrki

SCOPe Domain Coordinates for d1vtlf2:

Click to download the PDB-style file with coordinates for d1vtlf2.
(The format of our PDB-style files is described here.)

Timeline for d1vtlf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vtlf1