Lineage for d1vtle2 (1vtl E:107-198)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926122Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1926301Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 1926302Protein automated matches [227057] (3 species)
    not a true protein
  7. 1926318Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230343] (2 PDB entries)
  8. 1926324Domain d1vtle2: 1vtl E:107-198 [230345]
    automated match to d1mp9a2
    protein/DNA complex

Details for d1vtle2

PDB Entry: 1vtl (more details), 2.25 Å

PDB Description: co-crystal structure of tbp recognizing the minor groove of a tata element
PDB Compounds: (E:) tata binding protein (tbp)

SCOPe Domain Sequences for d1vtle2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vtle2 d.129.1.0 (E:107-198) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
pakfkdfkiqnivgscdvkfpirleglayshaafssyepelfpgliyrmkvpkivllifv
sgkivitgakmrdetykafeniypvlsefrki

SCOPe Domain Coordinates for d1vtle2:

Click to download the PDB-style file with coordinates for d1vtle2.
(The format of our PDB-style files is described here.)

Timeline for d1vtle2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vtle1