![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) ![]() |
![]() | Family d.129.1.0: automated matches [227265] (1 protein) not a true family |
![]() | Protein automated matches [227057] (3 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230343] (2 PDB entries) |
![]() | Domain d1vtle1: 1vtl E:13-106 [230344] automated match to d1mp9a1 protein/DNA complex |
PDB Entry: 1vtl (more details), 2.25 Å
SCOPe Domain Sequences for d1vtle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vtle1 d.129.1.0 (E:13-106) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} dlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttal ifasgkmvctgaksedfskmaarkyarivqklgf
Timeline for d1vtle1: