SCOPe 2.03: Domain d1vtle1: 1vtl E:13-106

Lineage for d1vtle1 (1vtl E:13-106)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.0: automated matches [227265] (1 protein)
   not a true family

6. Protein automated matches [227057] (3 species)
   not a true protein

7. Species Arabidopsis thaliana [TaxId:3702] [230343] (2 PDB entries)

8. Domain d1vtle1: 1vtl E:13-106 [230344]
   automated match to d1mp9a1
   protein/DNA complex

Details for d1vtle1

PDB Entry: 1vtl, 2.25 Å

PDB Description: co-crystal structure of tbp recognizing the minor groove of a tata element

PDB Compounds: (E:) tata binding protein (tbp)

SCOPe Domain Sequences for d1vtle1:

Sequence; same for both SEQRES and ATOM records:

>d1vtle1 d.129.1.0 (E:13-106) automated matches {Arabidopsis thaliana [TaxId: 3702]}
dlskhpsgivptlqnivstvnldckldlkaialqarnaeynpkrfaavimrirepkttal
ifasgkmvctgaksedfskmaarkyarivqklgf

Timeline for d1vtle1:

• d1vtle1 is new in SCOPe 2.03-stable
  
• d1vtle1 appears in SCOPe 2.04
  
• d1vtle1 appears in the current release, SCOPe 2.08