Lineage for d1oczo1 (1ocz O:91-227)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11128Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 11129Protein Cytochrome c oxidase [49544] (3 species)
  7. 11130Species Cow (Bos taurus) [TaxId:9913] [49545] (5 PDB entries)
  8. 11138Domain d1oczo1: 1ocz O:91-227 [23034]
    Other proteins in same PDB: d1ocza1, d1oczb2, d1oczc1, d1oczd1, d1ocze_, d1oczf_, d1oczg1, d1oczh_, d1oczi1, d1oczj1, d1oczk1, d1oczl1, d1oczm1, d1oczn1, d1oczo2, d1oczp1, d1oczq1, d1oczr_, d1oczs_, d1oczt1, d1oczu_, d1oczv1, d1oczw1, d1oczx1, d1oczy1, d1oczz1

Details for d1oczo1

PDB Entry: 1ocz (more details), 2.9 Å

PDB Description: bovine heart cytochrome c oxidase in azide-bound state

SCOP Domain Sequences for d1oczo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oczo1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d1oczo1:

Click to download the PDB-style file with coordinates for d1oczo1.
(The format of our PDB-style files is described here.)

Timeline for d1oczo1: