Lineage for d4kkxb_ (4kkx B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1874686Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1874687Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1874688Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1874857Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 1874874Species Salmonella enterica [TaxId:90371] [229810] (5 PDB entries)
  8. 1874879Domain d4kkxb_: 4kkx B: [230330]
    Other proteins in same PDB: d4kkxa_
    automated match to d4hpxb_
    complexed with aq3, edo, f6f, na, peg, pge

Details for d4kkxb_

PDB Entry: 4kkx (more details), 1.77 Å

PDB Description: crystal structure of tryptophan synthase from salmonella typhimurium with 2-aminophenol quinonoid in the beta site and the f6 inhibitor in the alpha site
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4kkxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkxb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge

SCOPe Domain Coordinates for d4kkxb_:

Click to download the PDB-style file with coordinates for d4kkxb_.
(The format of our PDB-style files is described here.)

Timeline for d4kkxb_: