SCOPe 2.03: Domain d4o5md2: 4o5m D:229-382

Lineage for d4o5md2 (4o5m D:229-382)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (15 species)
   not a true protein

7. Species Brucella suis [TaxId:204722] [230320] (1 PDB entry)

8. Domain d4o5md2: 4o5m D:229-382 [230321]
   Other proteins in same PDB: d4o5ma1, d4o5mb1, d4o5mc1, d4o5md1
   automated match to d1buca1
   complexed with ca, pg5

Details for d4o5md2

PDB Entry: 4o5m, 2.2 Å

PDB Description: X-ray Crystal Structure of Isovaleryl-CoA Dehydrogenase from Brucella suis

PDB Compounds: (D:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d4o5md2:

Sequence, based on SEQRES records:

>d4o5md2 a.29.3.0 (D:229-382) automated matches {Brucella suis [TaxId: 204722]}
gkgvnvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladm
yvtfnasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyp
tgrllrdaklyeigagtseirrmligrelfqetr

Sequence, based on observed residues (ATOM records):

>d4o5md2 a.29.3.0 (D:229-382) automated matches {Brucella suis [TaxId: 204722]}
gkgvnvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladm
yvtfnasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngdyptgr
llrdaklyeirmligrelfqetr

Timeline for d4o5md2:

• d4o5md2 is new in SCOPe 2.03-stable
  
• d4o5md2 appears in SCOPe 2.04
  
• d4o5md2 appears in the current release, SCOPe 2.08