Lineage for d1occo1 (1occ O:91-227)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106887Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 106888Protein Cytochrome c oxidase [49544] (3 species)
  7. 106889Species Cow (Bos taurus) [TaxId:9913] [49545] (5 PDB entries)
  8. 106895Domain d1occo1: 1occ O:91-227 [23032]
    Other proteins in same PDB: d1occa1, d1occb2, d1occc1, d1occd1, d1occe_, d1occf_, d1occg1, d1occh_, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo2, d1occp1, d1occq1, d1occr_, d1occs_, d1occt1, d1occu_, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occo1

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occo1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d1occo1:

Click to download the PDB-style file with coordinates for d1occo1.
(The format of our PDB-style files is described here.)

Timeline for d1occo1: