SCOPe 2.05: Domain d4o4qa_: 4o4q A:

Lineage for d4o4qa_ (4o4q A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (66 PDB entries)

8. Domain d4o4qa_: 4o4q A: [230313]
   automated match to d3mrwa_
   complexed with gol, nag, udp

Details for d4o4qa_

PDB Entry: 4o4q, 1.81 Å

PDB Description: crystal structure of the complex formed between type 1 ribosome inactivating protein and uridine diphosphate at 1.81 a resolution

PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4o4qa_:

Sequence; same for both SEQRES and ATOM records:

>d4o4qa_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d4o4qa_:

• d4o4qa_ first appeared in SCOPe 2.03
  
• d4o4qa_ appears in SCOPe 2.04
  
• d4o4qa_ appears in SCOPe 2.06
  
• d4o4qa_ appears in the current release, SCOPe 2.08