SCOPe 2.08: Domain d4nbyc_: 4nby C:

Lineage for d4nbyc_ (4nby C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4nbyc_: 4nby C: [230309]
   automated match to d4nbxb_

Details for d4nbyc_

PDB Entry: 4nby, 2.08 Å

PDB Description: Crystal Structure of TcdA-A2 Bound to Two Molecules of A20.1 VHH

PDB Compounds: (C:) a20.1 vhh

SCOPe Domain Sequences for d4nbyc_:

Sequence; same for both SEQRES and ATOM records:

>d4nbyc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagsstgrttyy
adsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyaywgqgtqvt
vss

Timeline for d4nbyc_:

• d4nbyc_ first appeared in SCOPe 2.03
  
• d4nbyc_ appears in SCOPe 2.07