Lineage for d4nc1c_ (4nc1 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2744004Domain d4nc1c_: 4nc1 C: [230308]
    Other proteins in same PDB: d4nc1e2, d4nc1f2
    automated match to d4nbxb_

Details for d4nc1c_

PDB Entry: 4nc1 (more details), 2.61 Å

PDB Description: Crystal Structure of TcdA-A2 Bound to A20.1 VHH and A26.8 VHH
PDB Compounds: (C:) a20.1 vhh

SCOPe Domain Sequences for d4nc1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nc1c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglaqaggslrlscaasgrtfsmdpmawfrqppgkerefvaagsstgrttyy
adsvkgrftisrdnakntvylqmnslkpedtavyycaaapyganwyrdeyaywgqgtqvt
vss

SCOPe Domain Coordinates for d4nc1c_:

Click to download the PDB-style file with coordinates for d4nc1c_.
(The format of our PDB-style files is described here.)

Timeline for d4nc1c_: