SCOPe 2.03: Domain d4nq1a_: 4nq1 A:

Lineage for d4nq1a_ (4nq1 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (51 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:423212] [230305] (1 PDB entry)

8. Domain d4nq1a_: 4nq1 A: [230306]
   automated match to d2ojpa_
   complexed with cl, mg, mpd, mrd

Details for d4nq1a_

PDB Entry: 4nq1, 1.65 Å

PDB Description: Legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site

PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d4nq1a_:

Sequence; same for both SEQRES and ATOM records:

>d4nq1a_ c.1.10.0 (A:) automated matches {Legionella pneumophila [TaxId: 423212]}
mfsgsivalvtpmrndsvdvhhlrelvefhiakgthalvaagttgeagtlshsekllvik
tvieqakervpviagtamnatkdcieltqqameygahaalimtpayikptqeglylhysh
iaqsvaipiilynvpgrtacdmlpetvarlakisniigixeatgqmtrlqqilrlcegsi
dvysgddltaaqwllsgakgvisvtanvaaklmakmcdlamdddqagclriqeqlmplhe
llfvesnpipvkwamkkmgliggelrlpmtelsekhhqalekvlknleli

Timeline for d4nq1a_:

• d4nq1a_ is new in SCOPe 2.03-stable
  
• d4nq1a_ appears in SCOPe 2.04
  
• d4nq1a_ appears in the current release, SCOPe 2.08