| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (51 species) not a true protein |
| Species Legionella pneumophila [TaxId:423212] [230305] (1 PDB entry) |
| Domain d4nq1a_: 4nq1 A: [230306] automated match to d2ojpa_ complexed with cl, mg, mpd, mrd |
PDB Entry: 4nq1 (more details), 1.65 Å
SCOPe Domain Sequences for d4nq1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nq1a_ c.1.10.0 (A:) automated matches {Legionella pneumophila [TaxId: 423212]}
mfsgsivalvtpmrndsvdvhhlrelvefhiakgthalvaagttgeagtlshsekllvik
tvieqakervpviagtamnatkdcieltqqameygahaalimtpayikptqeglylhysh
iaqsvaipiilynvpgrtacdmlpetvarlakisniigixeatgqmtrlqqilrlcegsi
dvysgddltaaqwllsgakgvisvtanvaaklmakmcdlamdddqagclriqeqlmplhe
llfvesnpipvkwamkkmgliggelrlpmtelsekhhqalekvlknleli
Timeline for d4nq1a_: